Search results for "thermal [cross section]"

showing 10 items of 1956 documents

Derivation of a Homogenized Two-Temperature Model from the Heat Equation

2014

This work studies the heat equation in a two-phase material with spherical inclusions. Under some appropriate scaling on the size, volume fraction and heat capacity of the inclusions, we derive a coupled system of partial differential equations governing the evolution of the temperature of each phase at a macroscopic level of description. The coupling terms describing the exchange of heat between the phases are obtained by using homogenization techniques originating from [D. Cioranescu, F. Murat: Coll\`ege de France Seminar vol. 2. (Paris 1979-1980) Res. Notes in Math. vol. 60, pp. 98-138. Pitman, Boston, London, 1982.]

01 natural sciencesHomogenization (chemistry)Heat capacity010305 fluids & plasmasTwo temperatureMathematics - Analysis of PDEsThermal nonequilibrium models0103 physical sciencesFOS: Mathematics[MATH.MATH-AP]Mathematics [math]/Analysis of PDEs [math.AP]0101 mathematicsScalingMSC 35K05 35B2776T05 (35Q79 76M50)35K05 35B27 76T05 (35Q79 76M50)MathematicsNumerical AnalysisHomogenizationPartial differential equationInfinite diffusion limitApplied MathematicsHeat equationMathematical analysis010101 applied mathematicsComputational MathematicsThermal non-equilibrium modelsModeling and SimulationVolume fractionHeat equationAnalysisAnalysis of PDEs (math.AP)
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

Experimental Equipment for Studying the Residual Stresses Developed During High Temperature Reactions by X-Ray Diffraction

1996

This paper describes a device dedicated to studyng, by X-ray diffraction the residual stresses developed on surface samples as a function of temperature and atmosphere conditions. The setup consists of : a.) an horizontal axis goniometer which allows the programmed positionning of the sealed X-ray source and of the linear detector. b.) a high temperature controlled atmosphere chamber Particular attention has been paid to the thermal stability up to 1200°C and the accurate position on the sample.

010302 applied physicsDiffractionControlled atmosphereChemistrybusiness.industryDetectorGeneral Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesAtmosphereOpticsResidual stressGoniometer[PHYS.HIST]Physics [physics]/Physics archives0103 physical sciencesX-ray crystallographyThermal stability0210 nano-technologybusiness
researchProduct

Coeval Cold Spray Additive Manufacturing Variances and Innovative Contributions

2017

Tremendous attention has been given to the cold spray process, even more today with the emergence of additive manufacturing, worldwide. Several inventions related to the cold spray technology have been patented for over a century and mostly since a couple of decades. But the cold spray technology knows a period of great innovations due to recent and current substantial explorations. Various technological solutions have been developed. The technical dimension, and particularly in terms of manufacturing method, has also always been a major genesis of progresses and novelties. This chapter is a technological survey of the cold spray additive manufacturing and reports variant methods and innova…

010302 applied physicsFlexibility (engineering)Engineeringbusiness.industryGas dynamic cold sprayThermal effect02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesManufacturing engineering0103 physical sciencesDeposition (phase transition)0210 nano-technologybusiness
researchProduct

Production of Nano-Sized Co<sub>3</sub>O<sub>4</sub> by Pyrolysis of Organic Extracts

2016

The most promising application field of materials based on nano-sized Co3O4 is catalysis. The method of production is one of the factors, which greatly affects the catalytic activity of Co3O4 catalysts. The aim of this research is to study possibilities of a new promising extractive-pyrolytic method (EPM) for the production of Co3O4 nanopowders and silica- and ceria-supported Co3O4 nanocomposites. Solutions of cobalt hexanoate in hexanoic acid and trioctylammonium tetrachlorocobaltate in toluene preliminary produced by solvent extraction were used as precursors. The precursors’ thermal stability, phase composition, morphology and the magnetic properties of the final products of pyrolysis we…

010302 applied physicsHexanoic acidNanocompositeMaterials scienceMechanical EngineeringInorganic chemistrychemistry.chemical_element02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesTolueneCatalysischemistry.chemical_compoundChemical engineeringchemistryMechanics of Materials0103 physical sciencesGeneral Materials ScienceThermal stabilityCrystallite0210 nano-technologyCobaltPyrolysisKey Engineering Materials
researchProduct

Cold gas dynamic spray additive manufacturing today: Deposit possibilities, technological solutions and viable applications

2017

This paper reports the current potentials of cold gas dynamic spraying (CGDS). CGDS has been significantly developed to produce several functional solutions categorized as follows: deposits with a single powder nature, composites-based deposits, nanotechnological deposits and hybrid coating/substrate assemblies. CGDS process has improved in proficiency and is still gaining attention from scientists and industry. Covering a wide range of materials, both standard and advanced, this additive manufacturing process offers substantial applications for surface functionalization, structural or dimensional restoration, bulk production providing specific material properties, and art/decoration. Progr…

010302 applied physicsMaterials processingManufacturing processbusiness.industryMechanical EngineeringNanotechnology02 engineering and technologySubstrate (printing)Advanced materialsengineering.material021001 nanoscience & nanotechnology01 natural sciencesCoatingMechanics of Materials0103 physical sciencesengineeringlcsh:TA401-492General Materials Sciencelcsh:Materials of engineering and construction. Mechanics of materials0210 nano-technologyThermal sprayingbusinessPolyvinylsMaterials & Design
researchProduct

Space charge accumulation in undersea HVDC cables as function of heat exchange conditions at the boundaries – water-air interface

2020

Transmission lines with undersea HVDC cables are an interesting technological solution for the supply of electrical energy to islands. The accumulation of space charge inside the dielectric layer of a HVDC cable is one of the most important element to consider in its design and during operation. The formation of space charge is due to various factors including the high dependence on the temperature of the electrical conductivity of the insulation and the establishment of a thermal gradient under load conditions. This research is focused on the space charge accumulation phenomenon around a section of a HVDC cable half dipped in water and half in air. Due to the high difference in thermal con…

010302 applied physicsMaterials science020209 energyElectric potential energy02 engineering and technologyMechanicsThermal conduction01 natural sciencesSpace chargeHVDC cables space charge sustainable islandsSettore ING-IND/31 - ElettrotecnicaTemperature gradientThermal conductivityElectric power transmissionElectric field0103 physical sciencesHeat exchanger0202 electrical engineering electronic engineering information engineering2020 IEEE 20th Mediterranean Electrotechnical Conference ( MELECON)
researchProduct

The effects of thermal treatment on structural, morphological and optical properties of electrochemically deposited Bi2S3 thin films

2017

Abstract Thin films of bismuth sulfide (Bi 2 S 3 ) have been electrochemically deposited on indium–doped tin oxide substrates from aqueous solutions of Bi(NO 3 ) 3 , ethylene diamine tetraacetic acid (EDTA) and Na 2 S 2 O 3 . The structural properties of the films were characterized using X–ray diffraction and high–resolution transmission electron microscopy analyses. The film crystallizes in an orthorhombic structure of Bi 2 S 3 along with metallic bismuth. Thermal annealing of the prepared film in sulfur atmosphere improves its crystallinity and cohesion. The band gap values of the deposited film before and after annealing at 400 °C were found to be 1.28 and 1.33 eV, respectively.

010302 applied physicsMaterials scienceAnnealing (metallurgy)Band gapInorganic chemistryMetals and Alloyschemistry.chemical_element02 engineering and technologySurfaces and InterfacesThermal treatment021001 nanoscience & nanotechnologyTin oxide01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsBismuthCrystallinitychemistryChemical engineeringTransmission electron microscopy0103 physical sciencesMaterials ChemistryThin film0210 nano-technologyThin Solid Films
researchProduct

Thermal expansion and polarization of (1-x)PNN-xPT solid solutions

2019

The paper presents the results of detailed studies of the thermal expansion of (1-x)PbNi1/3Nb2/3O3-xPbTiO3 solid solutions with x = 0-0.8. The anomalous and lattice contributions to deformation and...

010302 applied physicsMaterials scienceCondensed matter physics02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter PhysicsPolarization (waves)01 natural sciencesThermal expansionElectronic Optical and Magnetic MaterialsControl and Systems EngineeringLattice (order)0103 physical sciencesMaterials ChemistryCeramics and CompositesElectrical and Electronic Engineering0210 nano-technologySolid solutionIntegrated Ferroelectrics
researchProduct

Half-Heusler superlattices as model systems for nanostructured thermoelectrics

2015

The efficiency of thermoelectric materials is directly related to the dimensionless figure of merit , therefore, one of the means to improve ZT is to reduce the thermal conductivity. Our research focuses on half-Heusler superlattices (SLs) and the relationship between the SL period and the thermal conductivity. The cross-plane thermal conductivity of DC-sputtered TiNiSn/HfNiSn SLs was measured by the 3 method at room temperature and a clear reduction of was achieved for all SL periods, in particular for periods smaller than 20 nm. Moreover, the thermal conductivities of TiNiSn and HfNiSn single films display reduced values compared to the literature data for bulk materials. Furthermore, we …

010302 applied physicsMaterials scienceCondensed matter physicsDimensionless figure of meritSuperlattice02 engineering and technologySurfaces and InterfacesSurface finish021001 nanoscience & nanotechnologyCondensed Matter PhysicsThermoelectric materials01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsQuality (physics)Thermal conductivity0103 physical sciencesThermalMaterials ChemistryElectrical and Electronic Engineering0210 nano-technologyphysica status solidi (a)
researchProduct